PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_77CD244CE.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 329aa    MW: 34641.8 Da    PI: 9.9334
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_77CD244CE.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-39126187263
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                            keka++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Traes_2DL_77CD244CE.2 126 KEKAINCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 187
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30123184IPR003851Zinc finger, Dof-type
PfamPF027012.9E-33128184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MCGSSTTTLQ QHKQSCVFCV WCCTVEILDA PSPHSEPPHL HLSAACSLTT CYLPAGLGLV  60
KPMEEMLMGA PSANQQVQGS NPNPPAQAPS SAPGAGGPMR GGTPAMAVAG SGAGAGSTER  120
RPRPQKEKAI NCPRCNSTNT KFCYYNNYSL QQPRYFCKTC RRYWTEGGSL RNVPVGGGSR  180
KNKRSSSSSA SASASAAAST TASVANSSML GAAPNKNPKL AHEGAAHDLN LAFPHHQGGM  240
QAQAGYMAFP XPEPGEQQHV QPGRRRNGGQ WRPCRWRALR DGAAPEHRLL YAAPDADADA  300
RGVRRRGVLA RGVPRAGATA VAELARLLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3721170.0AK372117.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2146K16.
GenBankAK3759580.0AK375958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3111B19.
GenBankAM0843500.0AM084350.1 Hordeum vulgare subsp. vulgare dof2 gene for dof zinc finger protein 2, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580343.18e-66PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLW5BW880.0W5BW88_WHEAT; Uncharacterized protein
STRINGMLOC_68844.21e-107(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.19e-38Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]